PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006656m
Common NameEUTSA_v10006656mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 1036aa    MW: 114473 Da    PI: 8.3548
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006656mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.91.9e-40129206178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv++C++dls+ak+yhrrhkvCe hska+++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+++
  Thhalv10006656m 129 VCQVDNCTQDLSHAKDYHRRHKVCELHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNRRRRKTTQ 206
                      6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-33123191IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.941127204IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.54E-37128205IPR004333Transcription factor, SBP-box
PfamPF031101.3E-28130203IPR004333Transcription factor, SBP-box
PROSITE profilePS512969.004613661IPR017941Rieske [2Fe-2S] iron-sulphur domain
CDDcd002041.76E-10787924No hitNo description
SMARTSM002482000825854IPR002110Ankyrin repeat
SuperFamilySSF484031.74E-8826925IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.3E-8828938IPR020683Ankyrin repeat-containing domain
PfamPF127963.7E-6832931IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502979.33871943IPR020683Ankyrin repeat-containing domain
SMARTSM002480.25871901IPR002110Ankyrin repeat
SMARTSM002481500911947IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0016491Molecular Functionoxidoreductase activity
GO:0051537Molecular Function2 iron, 2 sulfur cluster binding
Sequence ? help Back to Top
Protein Sequence    Length: 1036 aa     Download sequence    Send to blast
MDEVGAQVAA PIFIHQSLSP MGRKRNLYYQ MSNRVAPSQP QPQRRDEWNS KMWDWDSRRF  60
EAKPVDAEVH LRLGNETQFD LNSRKEGEER GLDLNLGSCL NAVEDMTQAT RPSKKVRSGS  120
PGSGGNYPVC QVDNCTQDLS HAKDYHRRHK VCELHSKATK ALVGKQMQRF CQQCSRFHLL  180
SEFDEGKRSC RRRLAGHNRR RRKTTQPEEI ASGVGVPGNS DNTSIPNMDL MALLTTLACA  240
QGKNEVKPMG SPAVPNREQL LQILNKINAL PLPMDLVSKL NNIGSLARKN LDRPMVNPQN  300
DMNGASPSTM DLLAVLSATL GSSSPDALAI LSQGGFGNKD SDMTKLSSYD HGATTNLEKK  360
TVGGERSSSS NQSPSQDSDS HAQDTRSSLS LQLFTSSPED ESRPTVASSR KYYSSASSNP  420
VEDRSPSSSP VMQELFPLQT SPETMRSKNH KNTNPRTGGC LPLELFGASN RGAANPNFKG  480
FGQQSGYASS GSDYSPPSLN SDAQDRTGKI VFKLLDKDPS QLPGTLRTEI YNWLSSIPSE  540
MESYIRPGCV VLSVYVAMSP AAWEELEQNL LQRVGVLLQN SHSDFWKNAR FLVNTGRQLA  600
SHKNGRIRCS KSWRTWNSPE LISVSPVAVV AGEETSLVLR GRSLTNNGIS FRCTHMGSYM  660
SMEVAGAACK QGTFDELNVN SFSVKNAQRG SIGRCFIEVE NGFRGDSFPL IIANASICKE  720
LNRLEEEFHP KTQDMTGEQA QTSDRRPTSR EEILCFLNEL GWLFQKNQTS EPREQSDFSL  780
SRFKFLLVCS VERDYCALTR ALLDMLVERN LVNDELNREA LDMLAEIQLL NRAIKRKNTK  840
MVELLIHYSV DPAPLGSSKK FVFLPNITGP GGITPLHLAA CTSGSDDIVD LLTNDPQEIA  900
LSSWNSLCDA SGQTPFSYAA MRNNHTYNSL VARKLADKRN KQVSLNIENE IVDQTGVSRR  960
LSSEMNKSSC ATCATVALKY QRKVSGSHRF FPTPIIHSML AVATVCVCVC VFMHAFPIVR  1020
QGSHFSWGGL DYGSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31119203184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535540.0AK353554.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-52-I08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416342.10.0hypothetical protein EUTSA_v10006656mg
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLV4KAJ10.0V4KAJ1_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__2292__AT1G20980.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14